Lineage for d3zdxc_ (3zdx C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1554689Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1555148Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 1555149Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 proteins)
  6. 1555150Protein Integrin alpha N-terminal domain [69320] (2 species)
  7. 1555151Species Human (Homo sapiens), isoform IIb [TaxId:9606] [117285] (17 PDB entries)
    Uniprot P08514 32-483
  8. 1555161Domain d3zdxc_: 3zdx C: [201305]
    Other proteins in same PDB: d3zdxf1, d3zdxf2, d3zdxl1, d3zdxl2
    automated match to d3fcua_
    complexed with ca, cl, gol, mn, nag, so4

Details for d3zdxc_

PDB Entry: 3zdx (more details), 2.45 Å

PDB Description: integrin alphaiib beta3 headpiece and rgd peptide complex
PDB Compounds: (C:) integrin alpha-IIb

SCOPe Domain Sequences for d3zdxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zdxc_ b.69.8.1 (C:) Integrin alpha N-terminal domain {Human (Homo sapiens), isoform IIb [TaxId: 9606]}
lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
lrgavdiddngypdlivgayganqvavyraqpv

SCOPe Domain Coordinates for d3zdxc_:

Click to download the PDB-style file with coordinates for d3zdxc_.
(The format of our PDB-style files is described here.)

Timeline for d3zdxc_: