Lineage for d3zdga_ (3zdg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819478Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2819479Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries)
  8. 2819520Domain d3zdga_: 3zdg A: [201289]
    Other proteins in same PDB: d3zdgd_, d3zdge_, d3zdgf_, d3zdgg_
    automated match to d1uv6a_
    complexed with 1pe, nag, peg, so4, xrx

Details for d3zdga_

PDB Entry: 3zdg (more details), 2.48 Å

PDB Description: crystal structure of ls-achbp complexed with carbamoylcholine analogue 3-(dimethylamino)butyl dimethylcarbamate (dmabc)
PDB Compounds: (A:) acetylcholine binding protein

SCOPe Domain Sequences for d3zdga_:

Sequence, based on SEQRES records: (download)

>d3zdga_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d3zdga_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkknsvty
sccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3zdga_:

Click to download the PDB-style file with coordinates for d3zdga_.
(The format of our PDB-style files is described here.)

Timeline for d3zdga_: