SCOPe 2.06: Domain d3w5uh_: 3w5u H:

Lineage for d3w5uh_ (3w5u H:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein 2Fe-2S ferredoxin [54294] (19 species)

7. Species Maize (Zea mays) [TaxId:4577] [54305] (5 PDB entries)

8. Domain d3w5uh_: 3w5u H: [201282]
   Other proteins in same PDB: d3w5ua1, d3w5ua2, d3w5uc1, d3w5uc2, d3w5ue1, d3w5ue2, d3w5ug1, d3w5ug2
   automated match to d3w5ub_
   complexed with fad, fes

Details for d3w5uh_

PDB Entry: 3w5u, 2.7 Å

PDB Description: Cross-linked complex between Ferredoxin and Ferredoxin-NADP+ reductase

PDB Compounds: (H:) Ferredoxin-1, chloroplastic

SCOPe Domain Sequences for d3w5uh_:

Sequence; same for both SEQRES and ATOM records:

>d3w5uh_ d.15.4.1 (H:) 2Fe-2S ferredoxin {Maize (Zea mays) [TaxId: 4577]}
atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqcd
qsylddgqiadgwvltchayptsdvviethke

Timeline for d3w5uh_:

• d3w5uh_ first appeared in SCOPe 2.03
  
• d3w5uh_ appears in SCOPe 2.05
  
• d3w5uh_ appears in SCOPe 2.07
  
• d3w5uh_ appears in the current release, SCOPe 2.08