SCOPe 2.08: Domain d1miml1: 1mim L:1-105

Lineage for d1miml1 (1mim L:1-105)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (43 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d1miml1: 1mim L:1-105 [20128]
   Other proteins in same PDB: d1mimh1, d1mimh2, d1miml2
   part of CD25-binding humanized Fab CHI621

Details for d1miml1

PDB Entry: 1mim, 2.6 Å

PDB Description: igg fab fragment (cd25-binding)

PDB Compounds: (L:) chimeric sdz chi621

SCOPe Domain Sequences for d1miml1:

Sequence; same for both SEQRES and ATOM records:

>d1miml1 b.1.1.1 (L:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qivstqspaimsaspgekvtmtcsasssrsymqwyqqkpgtspkrwiydtsklasgvpar
fsgsgsgtsysltissmeaedaatyychqrssytfgggtkleikr

Timeline for d1miml1:

• d1miml1 first appeared (with stable ids) in SCOP 1.55
  
• d1miml1 appears in SCOPe 2.07