SCOPe 2.08: Domain d3w3eb_: 3w3e B:

Lineage for d3w3eb_ (3w3e B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.1: Family 19 glycosidase [53956] (2 proteins)
   automatically mapped to Pfam PF00182

6. Protein automated matches [190455] (7 species)
   not a true protein

7. Species Cowpea (Vigna unguiculata) [TaxId:3917] [193285] (1 PDB entry)

8. Domain d3w3eb_: 3w3e B: [201270]
   automated match to d3w3ea_

Details for d3w3eb_

PDB Entry: 3w3e, 1.5 Å

PDB Description: Structure of Vigna unguiculata chitinase with regulation activity of the plant cell wall

PDB Compounds: (B:) Cotyledoneous yieldin-like protein

SCOPe Domain Sequences for d3w3eb_:

Sequence; same for both SEQRES and ATOM records:

>d3w3eb_ d.2.1.1 (B:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
aevgsvigaslfdqllkhrndqacegkgfysynafitaarsfaafgttgdsntrkrevaa
flaqtshettggaatspdgpyawgycfvterdksnrycdgsgpcsagksyygrgpiqlth
nynynaagralgvdlinnpdlvardavvsfktalwfwmtpqgnkpschdvitnrwtpsaa
dkaanrvpgfgvitniingglecgkgptpasgdrigfykrycdvfgvsygpnlncrdqrp
fg

Timeline for d3w3eb_:

• d3w3eb_ first appeared in SCOPe 2.03
  
• d3w3eb_ appears in SCOPe 2.07