SCOP 1.59: Domain d1ad0d1: 1ad0 D:1-113

Lineage for d1ad0d1 (1ad0 D:1-113)

Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
Species Fab A5B7 (engineered human construct), kappa L chain [48823] (1 PDB entry)
Domain d1ad0d1: 1ad0 D:1-113 [20127]
Other proteins in same PDB: d1ad0a2, d1ad0b2, d1ad0c2, d1ad0d2

Details for d1ad0d1

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

SCOP Domain Sequences for d1ad0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0d1 b.1.1.1 (D:1-113) Immunoglobulin (variable domains of L and H chains) {Fab A5B7 (engineered human construct), kappa L chain}
evqllesggglvqpggslrlscatsgftftdyymnwvrqapgkglewlgfignkangytt
eysasvkgrftisrdkskstlylqmntlqaedsaiyyctrdrglrfyfdywgqgtlvtvs
s

SCOP Domain Coordinates for d1ad0d1:

Click to download the PDB-style file with coordinates for d1ad0d1.
(The format of our PDB-style files is described here.)

Timeline for d1ad0d1: