SCOPe 2.04: Domain d3vppa_: 3vpp A:

Lineage for d3vppa_ (3vpp A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)

8. Domain d3vppa_: 3vpp A: [201254]
   automated match to d3vppb_
   complexed with ca

Details for d3vppa_

PDB Entry: 3vpp, 1.64 Å

PDB Description: crystal structure of the human clec9a c-type lectin-like domain

PDB Compounds: (A:) C-type lectin domain family 9 member A

SCOPe Domain Sequences for d3vppa_:

Sequence, based on SEQRES records:

>d3vppa_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcpnnwiqnrescyyvseiwsiwhtsqenclkegstllqieskeemdfitgslrkikgs
ydywvglsqdghsgrwlwqdgsspspgllpaersqsanqvcgyvksnsllssncdtwkyf
icekyal

Sequence, based on observed residues (ATOM records):

>d3vppa_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcpnnwiqnrescyyvseiwsiwhtsqenclkegstllqieskeemdfitgslrkikgs
ydywvglsqdghsgrwlwqdgsspspgllpaeqvcgyvksnsllssncdtwkyficekya
l

Timeline for d3vppa_:

• d3vppa_ first appeared in SCOPe 2.03
  
• d3vppa_ appears in SCOPe 2.05
  
• d3vppa_ appears in the current release, SCOPe 2.08