Lineage for d3vppa_ (3vpp A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443271Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries)
  8. 1443307Domain d3vppa_: 3vpp A: [201254]
    automated match to d3vppb_
    complexed with ca

Details for d3vppa_

PDB Entry: 3vpp (more details), 1.64 Å

PDB Description: crystal structure of the human clec9a c-type lectin-like domain
PDB Compounds: (A:) C-type lectin domain family 9 member A

SCOPe Domain Sequences for d3vppa_:

Sequence, based on SEQRES records: (download)

>d3vppa_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcpnnwiqnrescyyvseiwsiwhtsqenclkegstllqieskeemdfitgslrkikgs
ydywvglsqdghsgrwlwqdgsspspgllpaersqsanqvcgyvksnsllssncdtwkyf
icekyal

Sequence, based on observed residues (ATOM records): (download)

>d3vppa_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spcpnnwiqnrescyyvseiwsiwhtsqenclkegstllqieskeemdfitgslrkikgs
ydywvglsqdghsgrwlwqdgsspspgllpaeqvcgyvksnsllssncdtwkyficekya
l

SCOPe Domain Coordinates for d3vppa_:

Click to download the PDB-style file with coordinates for d3vppa_.
(The format of our PDB-style files is described here.)

Timeline for d3vppa_: