SCOPe 2.05: Domain d3vpma_: 3vpm A:

Lineage for d3vpma_ (3vpm A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein automated matches [190435] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193902] (6 PDB entries)

8. Domain d3vpma_: 3vpm A: [201251]
   automated match to d3vpmb_
   complexed with fe, mg; mutant

Details for d3vpma_

PDB Entry: 3vpm, 2.7 Å

PDB Description: crystal structure of human ribonucleotide reductase subunit m2 (hrrm2) mutant

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit M2

SCOPe Domain Sequences for d3vpma_:

Sequence; same for both SEQRES and ATOM records:

>d3vpma_ a.25.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeavdlskdiqhweslkpeer
yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi
kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif
wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl
tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

Timeline for d3vpma_:

• d3vpma_ first appeared in SCOPe 2.03
  
• d3vpma_ appears in SCOPe 2.04
  
• d3vpma_ is called d3vpma1 in SCOPe 2.06
  
• d3vpma_ appears in the current release, SCOPe 2.08, called d3vpma1