Lineage for d3vpma_ (3vpm A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265471Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1265763Protein automated matches [190435] (8 species)
    not a true protein
  7. 1265795Species Human (Homo sapiens) [TaxId:9606] [193902] (5 PDB entries)
  8. 1265806Domain d3vpma_: 3vpm A: [201251]
    automated match to d3vpmb_
    complexed with fe, mg; mutant

Details for d3vpma_

PDB Entry: 3vpm (more details), 2.7 Å

PDB Description: crystal structure of human ribonucleotide reductase subunit m2 (hrrm2) mutant
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit M2

SCOPe Domain Sequences for d3vpma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vpma_ a.25.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvedepllrenprrfvifpieyhdiwqmykkaeasfwtaeavdlskdiqhweslkpeer
yfishvlaffaasdgivnenlverfsqevqitearcfygfqiamenihsemysllidtyi
kdpkereflfnaietmpcvkkkadwalrwigdkeatygervvafaavegiffsgsfasif
wlkkrglmpgltfsnelisrdeglhcdfaclmfkhlvhkpseervreiiinavrieqefl
tealpvkligmnctlmkqyiefvadrlmlelgfskvfrvenpfdfm

SCOPe Domain Coordinates for d3vpma_:

Click to download the PDB-style file with coordinates for d3vpma_.
(The format of our PDB-style files is described here.)

Timeline for d3vpma_: