Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab A5B7 (engineered human construct), kappa L chain [48823] (1 PDB entry) |
Domain d1ad0a1: 1ad0 A:1-107 [20124] Other proteins in same PDB: d1ad0a2, d1ad0b2, d1ad0c2, d1ad0d2 |
PDB Entry: 1ad0 (more details), 2.5 Å
SCOP Domain Sequences for d1ad0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ad0a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab A5B7 (engineered human construct), kappa L chain} qtvltqspsslsvsvgdrvtitcrasssvtyihwyqqkpglapksliyatsnlasgvpsr fsgsgsgtdytftisslqpediatyycqhwsskpptfgqgtkvevkr
Timeline for d1ad0a1: