Lineage for d1ad0a1 (1ad0 A:1-107)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102501Species Fab A5B7 (engineered human construct), kappa L chain [48823] (1 PDB entry)
  8. 102502Domain d1ad0a1: 1ad0 A:1-107 [20124]
    Other proteins in same PDB: d1ad0a2, d1ad0b2, d1ad0c2, d1ad0d2

Details for d1ad0a1

PDB Entry: 1ad0 (more details), 2.5 Å

PDB Description: fab fragment of engineered human monoclonal antibody a5b7

SCOP Domain Sequences for d1ad0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ad0a1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab A5B7 (engineered human construct), kappa L chain}
qtvltqspsslsvsvgdrvtitcrasssvtyihwyqqkpglapksliyatsnlasgvpsr
fsgsgsgtdytftisslqpediatyycqhwsskpptfgqgtkvevkr

SCOP Domain Coordinates for d1ad0a1:

Click to download the PDB-style file with coordinates for d1ad0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ad0a1: