Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab A5B7 (mouse), kappa L chain [48822] (1 PDB entry) |
Domain d1cloh1: 1clo H:1-113 [20123] Other proteins in same PDB: d1cloh2, d1clol2 |
PDB Entry: 1clo (more details), 2.1 Å
SCOP Domain Sequences for d1cloh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cloh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab A5B7 (mouse), kappa L chain} evklvesggglvqpggslrlscatsgftftdyymnwvrqppgkalewlgfignkangytt eysasvkgrftisrdksqsilylqmntlraedsatyyctrdrglrfyfdywgqgttltvs s
Timeline for d1cloh1: