SCOPe 2.04: Domain d3va2a_: 3va2 A:

Lineage for d3va2a_ (3va2 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (13 PDB entries)

8. Domain d3va2a_: 3va2 A: [201212]
   automated match to d3va2b_

Details for d3va2a_

PDB Entry: 3va2, 2.7 Å

PDB Description: Crystal structure of human Interleukin-5 in complex with its alpha receptor

PDB Compounds: (A:) Interleukin-5

SCOPe Domain Sequences for d3va2a_:

Sequence; same for both SEQRES and ATOM records:

>d3va2a_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggt
verlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntew

Timeline for d3va2a_:

• d3va2a_ first appeared in SCOPe 2.03
  
• d3va2a_ appears in SCOPe 2.05
  
• d3va2a_ appears in the current release, SCOPe 2.08