Lineage for d3v5ld_ (3v5l D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673870Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
    PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase
  7. 1673871Species Human (Homo sapiens) [TaxId:9606] [111195] (28 PDB entries)
    Uniprot Q08881 357-619
  8. 1673886Domain d3v5ld_: 3v5l D: [201200]
    automated match to d3v8wb_
    complexed with 0g1, so4

Details for d3v5ld_

PDB Entry: 3v5l (more details), 1.86 Å

PDB Description: crystal structure of interleukin-2 inducible t-cell kinase itk catalytic domain with thienopyrazolylindole inhibitor 542
PDB Compounds: (D:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d3v5ld_:

Sequence, based on SEQRES records: (download)

>d3v5ld_ d.144.1.7 (D:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls
hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle
eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqytsstgtkfpvkwaspevfsfsr
yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc
wkerpedrpafsrllrqlaeiaesg

Sequence, based on observed residues (ATOM records): (download)

>d3v5ld_ d.144.1.7 (D:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
gsvidpseltfvqeigsgqglvhlgywlnkdkvaiktiramseedfieeaevmmklshpk
lvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeac
vihrdlaarnclvgenqvikvsdfgmfpvkwaspevfsfsryssksdvwsfgvlmwevfs
egkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqla
eiaesg

SCOPe Domain Coordinates for d3v5ld_:

Click to download the PDB-style file with coordinates for d3v5ld_.
(The format of our PDB-style files is described here.)

Timeline for d3v5ld_: