Lineage for d1fj1b1 (1fj1 B:1-114)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930165Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
    Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10
  8. 930192Domain d1fj1b1: 1fj1 B:1-114 [20119]
    Other proteins in same PDB: d1fj1a1, d1fj1a2, d1fj1b2, d1fj1c1, d1fj1c2, d1fj1d2, d1fj1e_, d1fj1f_
    part of Fab LA-2 against OspA

Details for d1fj1b1

PDB Entry: 1fj1 (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (B:) hybridoma antibody la2 (heavy chain)

SCOPe Domain Sequences for d1fj1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj1b1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytftdysmywvkqapgkglkrmgwintetgepty
addfkgrfalsldtsastaylhisnlknedtatyfcargldswgqgtsvtvssa

SCOPe Domain Coordinates for d1fj1b1:

Click to download the PDB-style file with coordinates for d1fj1b1.
(The format of our PDB-style files is described here.)

Timeline for d1fj1b1: