Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab 184.1 (mouse), kappa L chain [48820] (1 PDB entry) against OspA |
Domain d1osph1: 1osp H:1-120 [20117] Other proteins in same PDB: d1osph2, d1ospl2, d1ospo_ mutant |
PDB Entry: 1osp (more details), 1.95 Å
SCOP Domain Sequences for d1osph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1osph1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab 184.1 (mouse), kappa L chain} evqlqesgpslvkpsqtlsltcsvtgepitsgfwdwirkfpgnklefmgyirygggtyyn pslkspisitrdtsknhyylqlnsvvtedtatyycarsrdyygssgfafwgegtlvtvsa
Timeline for d1osph1: