SCOP 1.63: Domain d1osph1: 1osp H:1-120

Lineage for d1osph1 (1osp H:1-120)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 184.1 (mouse), kappa L chain [48820] (1 PDB entry)
   against OspA

8. Domain d1osph1: 1osp H:1-120 [20117]
   Other proteins in same PDB: d1osph2, d1ospl2, d1ospo_
   mutant

Details for d1osph1

PDB Entry: 1osp, 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab

SCOP Domain Sequences for d1osph1:

Sequence; same for both SEQRES and ATOM records:

>d1osph1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab 184.1 (mouse), kappa L chain}
evqlqesgpslvkpsqtlsltcsvtgepitsgfwdwirkfpgnklefmgyirygggtyyn
pslkspisitrdtsknhyylqlnsvvtedtatyycarsrdyygssgfafwgegtlvtvsa

Timeline for d1osph1:

• d1osph1 first appeared (with stable ids) in SCOP 1.55
  
• d1osph1 appears in SCOP 1.61
  
• d1osph1 appears in SCOP 1.65
  
• d1osph1 appears in the current release, SCOPe 2.08