SCOPe 2.08: Domain d3v4db1: 3v4d B:1-126

Lineage for d3v4db1 (3v4d B:1-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (4 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.0: automated matches [191544] (1 protein)
   not a true family

6. Protein automated matches [190935] (24 species)
   not a true protein

7. Species Escherichia coli [TaxId:217992] [196085] (1 PDB entry)

8. Domain d3v4db1: 3v4d B:1-126 [201153]
   Other proteins in same PDB: d3v4db2, d3v4dc2, d3v4dd2, d3v4de2, d3v4df2
   automated match to d3v4dc_

Details for d3v4db1

PDB Entry: 3v4d, 1.95 Å

PDB Description: crystal structure of rutc protein a member of the yjgf family from e.coli

PDB Compounds: (B:) Aminoacrylate peracid reductase RutC

SCOPe Domain Sequences for d3v4db1:

Sequence, based on SEQRES records:

>d3v4db1 d.79.1.0 (B:1-126) automated matches {Escherichia coli [TaxId: 217992]}
mpksviipagssaplapfvpgtladgvvyvsgtlafdqhnnvlfaddpkaqtrhvletir
kvietaggtmadvtfnsifitdwknyaaineiyaeffpgdkparfciqcglvkpdalvei
atiahi

Sequence, based on observed residues (ATOM records):

>d3v4db1 d.79.1.0 (B:1-126) automated matches {Escherichia coli [TaxId: 217992]}
mpksviipagssaapfvpgtladgvvyvsgtlafdqhnnvlfaddpkaqtrhvletirkv
ietaggtmadvtfnsifitdwknyaaineiyaeffpgdkparfciqcglvkpdalveiat
iahi

Timeline for d3v4db1:

• d3v4db1 first appeared in SCOPe 2.03, called d3v4db_
  
• d3v4db1 appears in SCOPe 2.07