SCOPe 2.05: Domain d3v3ym_: 3v3y M:

Lineage for d3v3ym_ (3v3y M:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
   Uniprot P02953

8. Domain d3v3ym_: 3v3y M: [201149]
   Other proteins in same PDB: d3v3yh1, d3v3yh2, d3v3yl_
   automated match to d3v3zm_
   complexed with bcl, bph, cl, dio, fe, lda, po4, spn, u10

Details for d3v3ym_

PDB Entry: 3v3y, 2.8 Å

PDB Description: Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3v3ym_:

Sequence; same for both SEQRES and ATOM records:

>d3v3ym_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqniftqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d3v3ym_:

• d3v3ym_ first appeared in SCOPe 2.03
  
• d3v3ym_ appears in SCOPe 2.04
  
• d3v3ym_ appears in SCOPe 2.06
  
• d3v3ym_ appears in the current release, SCOPe 2.08