SCOPe 2.03: Domain d3uzqa2: 3uzq A:134-245

Lineage for d3uzqa2 (3uzq A:134-245)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d3uzqa2: 3uzq A:134-245 [201135]
   Other proteins in same PDB: d3uzqb_
   automated match to d1nqba2
   complexed with edo, gol, mes

Details for d3uzqa2

PDB Entry: 3uzq, 1.6 Å

PDB Description: Crystal structure of the dengue virus serotype 1 envelope protein domain III in complex with the variable domains of Mab 4E11

PDB Compounds: (A:) anti-dengue Mab 4E11

SCOPe Domain Sequences for d3uzqa2:

Sequence; same for both SEQRES and ATOM records:

>d3uzqa2 b.1.1.0 (A:134-245) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvmtqtpaslavslgqratiscrasenvdrygnsfmhwyqqkagqppklliyrasnlesg
iparfsgsgsrtdftltinpveaddvatyfcqrsnevpwtfgggtkleikrp

Timeline for d3uzqa2:

• d3uzqa2 is new in SCOPe 2.03-stable
  
• d3uzqa2 appears in SCOPe 2.04
  
• d3uzqa2 appears in the current release, SCOPe 2.08