Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (19 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [189852] (8 PDB entries) |
Domain d3uy6a_: 3uy6 A: [201131] automated match to d3uy6b_ complexed with gol, so4; mutant |
PDB Entry: 3uy6 (more details), 2.1 Å
SCOPe Domain Sequences for d3uy6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uy6a_ e.3.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvvwyferisdqipk nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli sekilkemgvln
Timeline for d3uy6a_: