Lineage for d1kelh1 (1kel H:1-115)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1103461Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1103715Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (46 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1103730Domain d1kelh1: 1kel H:1-115 [20113]
    Other proteins in same PDB: d1kelh2, d1kell1, d1kell2
    part of Fab 28B4
    complexed with aah

Details for d1kelh1

PDB Entry: 1kel (more details), 1.9 Å

PDB Description: catalytic antibody 28b4 fab fragment complexed with hapten (1-[n-4'-nitrobenzyl-n-4'-carboxybutylamino] methylphosphonic acid)
PDB Compounds: (H:) 28b4 fab

SCOPe Domain Sequences for d1kelh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kelh1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglgqpggslrlscatsgftftdyyfnwarqppgkalewlgfirnkakgytt
eysasvkgrftisrdnsqgilylqmntlraedsatyycarwgsyamdywgqgtsv

SCOPe Domain Coordinates for d1kelh1:

Click to download the PDB-style file with coordinates for d1kelh1.
(The format of our PDB-style files is described here.)

Timeline for d1kelh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kelh2