Lineage for d1nldh1 (1nld H:1-112)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782455Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 782497Domain d1nldh1: 1nld H:1-112 [20111]
    Other proteins in same PDB: d1nldh2, d1nldl1, d1nldl2
    part of Fab 1583

Details for d1nldh1

PDB Entry: 1nld (more details), 2.9 Å

PDB Description: fab fragment of a neutralizing antibody directed against an epitope of gp41 from hiv-1
PDB Compounds: (H:) fab1583

SCOP Domain Sequences for d1nldh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nldh1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvklqqsgpglvqpsqslsitctvsgfsltcygvhwvrqspgkglewlgviwsggdtdyn
aafisrlsitkdnsksqvffkmnslqpndraiyycarrggdfwgqgttvtvs

SCOP Domain Coordinates for d1nldh1:

Click to download the PDB-style file with coordinates for d1nldh1.
(The format of our PDB-style files is described here.)

Timeline for d1nldh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nldh2