SCOP 1.67: Domain d1ghfh1: 1ghf H:1-115

Lineage for d1ghfh1 (1ghf H:1-115)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (29 PDB entries)

8. Domain d1ghfh1: 1ghf H:1-115 [20109]
   Other proteins in same PDB: d1ghfh2, d1ghfl1, d1ghfl2
   part of Fab GH1002

Details for d1ghfh1

PDB Entry: 1ghf, 2.7 Å

PDB Description: anti-anti-idiotype gh1002 fab fragment

SCOP Domain Sequences for d1ghfh1:

Sequence; same for both SEQRES and ATOM records:

>d1ghfh1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
vqlqqsgpelkkpgetvkiscklwytftdygmnwvkqapgkglkwmgwiqtnteeptyga
efkgrfafsletsaftaykqinnlknedmatyfcarveagfdywaqgttltvss

Timeline for d1ghfh1:

• d1ghfh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ghfh1 appears in SCOP 1.65
  
• d1ghfh1 appears in SCOP 1.69
  
• d1ghfh1 appears in the current release, SCOPe 2.08