SCOP 1.61: Domain d1ghfl1: 1ghf L:1-107

Lineage for d1ghfl1 (1ghf L:1-107)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab GH1002 (mouse), kappa L chain [48817] (1 PDB entry)

8. Domain d1ghfl1: 1ghf L:1-107 [20108]
   Other proteins in same PDB: d1ghfh2, d1ghfl2

Details for d1ghfl1

PDB Entry: 1ghf, 2.7 Å

PDB Description: anti-anti-idiotype gh1002 fab fragment

SCOP Domain Sequences for d1ghfl1:

Sequence; same for both SEQRES and ATOM records:

>d1ghfl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab GH1002 (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscresqdisnslnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgtgtdysltisnleqedfatyfcqqgntlpytfgggtkleik

Timeline for d1ghfl1:

• d1ghfl1 first appeared (with stable ids) in SCOP 1.55
  
• d1ghfl1 appears in SCOP 1.59
  
• d1ghfl1 appears in SCOP 1.63
  
• d1ghfl1 appears in the current release, SCOPe 2.08