Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species) contains an extension to the common fold at the N-terminus |
Domain d3unfu_: 3unf U: [201070] Other proteins in same PDB: d3unfa_, d3unfb_, d3unfc_, d3unfd_, d3unfe_, d3unff_, d3unfh_, d3unfi_, d3unfj_, d3unfk_, d3unfl_, d3unfm_, d3unfn_, d3unfo_, d3unfp_, d3unfq_, d3unfr_, d3unfs_, d3unft_, d3unfv_, d3unfw_, d3unfx_, d3unfy_, d3unfz_ automated match to d3unbu_ complexed with 04c, cl, iod, k |
PDB Entry: 3unf (more details), 2.9 Å
SCOPe Domain Sequences for d3unfu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3unfu_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Mouse (Mus musculus) [TaxId: 10090]} srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkll dsstvthlfkitesigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi sqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflek kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva lae
Timeline for d3unfu_: