SCOP 1.59: Domain d1dvfd_: 1dvf D:

Lineage for d1dvfd_ (1dvf D:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fv E5.2 (mouse), kappa L chain [48816] (1 PDB entry)

8. Domain d1dvfd_: 1dvf D: [20107]

Details for d1dvfd_

PDB Entry: 1dvf, 1.9 Å

PDB Description: idiotopic antibody d1.3 fv fragment-antiidiotopic antibody e5.2 fv fragment complex

SCOP Domain Sequences for d1dvfd_:

Sequence; same for both SEQRES and ATOM records:

>d1dvfd_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {Fv E5.2 (mouse), kappa L chain}
qvqlqqsgtelvksgasvklsctasgfnikdthmnwvkqrpeqglewigridpangniqy
dpkfrgkatitadtssntaylqlsltsedtavyycatkviyyqgrgamdywgqgttltvs

Timeline for d1dvfd_:

• d1dvfd_ first appeared (with stable ids) in SCOP 1.55
  
• d1dvfd_ appears in SCOP 1.57
  
• d1dvfd_ appears in SCOP 1.61
  
• d1dvfd_ appears in the current release, SCOPe 2.08, called d1dvfd1