Lineage for d1dvfd_ (1dvf D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7907Species Fv E5.2 (mouse), kappa L chain [48816] (1 PDB entry)
  8. 7909Domain d1dvfd_: 1dvf D: [20107]

Details for d1dvfd_

PDB Entry: 1dvf (more details), 1.9 Å

PDB Description: idiotopic antibody d1.3 fv fragment-antiidiotopic antibody e5.2 fv fragment complex

SCOP Domain Sequences for d1dvfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvfd_ b.1.1.1 (D:) Immunoglobulin (variable domains of L and H chains) {Fv E5.2 (mouse), kappa L chain}
qvqlqqsgtelvksgasvklsctasgfnikdthmnwvkqrpeqglewigridpangniqy
dpkfrgkatitadtssntaylqlsltsedtavyycatkviyyqgrgamdywgqgttltvs

SCOP Domain Coordinates for d1dvfd_:

Click to download the PDB-style file with coordinates for d1dvfd_.
(The format of our PDB-style files is described here.)

Timeline for d1dvfd_: