Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Domain d3unft_: 3unf T: [201069] Other proteins in same PDB: d3unfb_, d3unfc_, d3unfe_, d3unfg_, d3unfn_, d3unfp_, d3unfq_, d3unfs_, d3unfu_ automated match to d3unbt_ complexed with 04c, cl, iod, k |
PDB Entry: 3unf (more details), 2.9 Å
SCOPe Domain Sequences for d3unft_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3unft_ d.153.1.4 (T:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyee gsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvh aytlysavrpfgcsfmlgsysandgaqlymidpsgvsygywgcaigkarqaakteieklq mkemtcrdvvkevakiiyivhdevkdkafelelswvgeltkgrheivpkdireeaekyak eslk
Timeline for d3unft_: