Lineage for d3unfs_ (3unf S:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1439841Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1439842Protein automated matches [190509] (8 species)
    not a true protein
  7. 1439875Species Mouse (Mus musculus) [TaxId:10090] [195930] (2 PDB entries)
  8. 1439882Domain d3unfs_: 3unf S: [201068]
    Other proteins in same PDB: d3unfa_, d3unfd_, d3unff_, d3unfg_, d3unfh_, d3unfi_, d3unfj_, d3unfk_, d3unfl_, d3unfm_, d3unfo_, d3unfr_, d3unft_, d3unfu_, d3unfv_, d3unfw_, d3unfx_, d3unfy_, d3unfz_
    automated match to d4g4se_
    complexed with 04c, cl, iod, k

Details for d3unfs_

PDB Entry: 3unf (more details), 2.9 Å

PDB Description: Mouse 20S immunoproteasome in complex with PR-957
PDB Compounds: (S:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d3unfs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3unfs_ d.153.1.0 (S:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
grrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefmecn
ldelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspfldgleerpq

SCOPe Domain Coordinates for d3unfs_:

Click to download the PDB-style file with coordinates for d3unfs_.
(The format of our PDB-style files is described here.)

Timeline for d3unfs_: