SCOPe 2.08: Domain d3unbs_: 3unb S:

Lineage for d3unbs_ (3unb S:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [195930] (2 PDB entries)

8. Domain d3unbs_: 3unb S: [201050]
   Other proteins in same PDB: d3unb1_, d3unb2_, d3unb3_, d3unb4_, d3unba_, d3unbb_, d3unbc_, d3unbd_, d3unbf_, d3unbg_, d3unbh_, d3unbi_, d3unbj_, d3unbk_, d3unbl_, d3unbm_, d3unbn_, d3unbo_, d3unbp_, d3unbq_, d3unbr_, d3unbt_, d3unbu_, d3unbv_, d3unbw_, d3unbx_, d3unby_, d3unbz_
   automated match to d4g4se_
   complexed with 04c

Details for d3unbs_

PDB Entry: 3unb, 2.9 Å

PDB Description: Mouse constitutive 20S proteasome in complex with PR-957

PDB Compounds: (S:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d3unbs_:

Sequence; same for both SEQRES and ATOM records:

>d3unbs_ d.153.1.0 (S:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
grrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefmecn
ldelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspfldgleerpq

Timeline for d3unbs_:

• d3unbs_ first appeared in SCOPe 2.03
  
• d3unbs_ appears in SCOPe 2.07