SCOPe 2.03: Domain d1clzh1: 1clz H:1-113

Lineage for d1clzh1 (1clz H:1-113)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d1clzh1: 1clz H:1-113 [20105]
   Other proteins in same PDB: d1clzh2, d1clzl1, d1clzl2
   part of Fab MBR96
   complexed with non

Details for d1clzh1

PDB Entry: 1clz, 2.8 Å

PDB Description: igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester

PDB Compounds: (H:) igg fab (igg3, kappa)

SCOPe Domain Sequences for d1clzh1:

Sequence; same for both SEQRES and ATOM records:

>d1clzh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsv

Timeline for d1clzh1:

• d1clzh1 first appeared (with stable ids) in SCOP 1.55
  
• d1clzh1 appears in SCOPe 2.02
  
• d1clzh1 appears in SCOPe 2.04
  
• d1clzh1 appears in the current release, SCOPe 2.08