SCOP 1.59: Domain d1clzh1: 1clz H:1-113

Lineage for d1clzh1 (1clz H:1-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab MBR96 (mouse), kappa L chain [48815] (1 PDB entry)

8. Domain d1clzh1: 1clz H:1-113 [20105]
   Other proteins in same PDB: d1clzh2, d1clzl2

Details for d1clzh1

PDB Entry: 1clz, 2.8 Å

PDB Description: igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clzh1:

Sequence; same for both SEQRES and ATOM records:

>d1clzh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab MBR96 (mouse), kappa L chain}
evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsv

Timeline for d1clzh1:

• d1clzh1 first appeared (with stable ids) in SCOP 1.55
  
• d1clzh1 appears in SCOP 1.57
  
• d1clzh1 appears in SCOP 1.61
  
• d1clzh1 appears in the current release, SCOPe 2.08