Lineage for d1clyh1 (1cly H:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740087Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2740121Domain d1clyh1: 1cly H:1-113 [20103]
    Other proteins in same PDB: d1clyh2, d1clyl1, d1clyl2
    part of humanized Fab CBR96
    complexed with non

Details for d1clyh1

PDB Entry: 1cly (more details), 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester
PDB Compounds: (H:) igg fab (human igg1, kappa)

SCOPe Domain Sequences for d1clyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clyh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evnlvesggglvqpggslkvscvtsgftfsdyymywvrqtpekrlewvayisqggditdy
pdtvkgrftisrdnaknslylqmsrlksedtamyycarglddgawfaywgqgtlvtvsv

SCOPe Domain Coordinates for d1clyh1:

Click to download the PDB-style file with coordinates for d1clyh1.
(The format of our PDB-style files is described here.)

Timeline for d1clyh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clyh2