SCOP 1.71: Domain d1clyl1: 1cly L:3-108

Lineage for d1clyl1 (1cly L:3-108)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1clyl1: 1cly L:3-108 [20102]
   Other proteins in same PDB: d1clyh1, d1clyh2, d1clyl2
   part of humanized Fab CBR96
   complexed with fuc, gal, nag, non

Details for d1clyl1

PDB Entry: 1cly, 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clyl1:

Sequence; same for both SEQRES and ATOM records:

>d1clyl1 b.1.1.1 (L:3-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
lmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsg
vpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr

Timeline for d1clyl1:

• d1clyl1 first appeared (with stable ids) in SCOP 1.55
  
• d1clyl1 appears in SCOP 1.69
  
• d1clyl1 appears in SCOP 1.73
  
• d1clyl1 appears in the current release, SCOPe 2.08