Lineage for d1clyl1 (1cly L:3-108)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158036Species Fab CBR96 (mouse/human), kappa L chain [48814] (2 PDB entries)
  8. 158040Domain d1clyl1: 1cly L:3-108 [20102]
    Other proteins in same PDB: d1clyh2, d1clyl2

Details for d1clyl1

PDB Entry: 1cly (more details), 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clyl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clyl1 b.1.1.1 (L:3-108) Immunoglobulin (variable domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
lmtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsg
vpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr

SCOP Domain Coordinates for d1clyl1:

Click to download the PDB-style file with coordinates for d1clyl1.
(The format of our PDB-style files is described here.)

Timeline for d1clyl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clyl2