Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab CBR96 (mouse/human), kappa L chain [48814] (2 PDB entries) |
Domain d1ucbl1: 1ucb L:4-108 [20100] Other proteins in same PDB: d1ucbh2, d1ucbl2 |
PDB Entry: 1ucb (more details), 2.5 Å
SCOP Domain Sequences for d1ucbl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ucbl1 b.1.1.1 (L:4-108) Immunoglobulin (variable domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain} mtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsgv pdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr
Timeline for d1ucbl1: