Lineage for d1ucbl1 (1ucb L:4-108)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7539Species Fab CBR96 (mouse/human), kappa L chain [48814] (2 PDB entries)
  8. 7541Domain d1ucbl1: 1ucb L:4-108 [20100]
    Other proteins in same PDB: d1ucbh2, d1ucbl2

Details for d1ucbl1

PDB Entry: 1ucb (more details), 2.5 Å

PDB Description: structure of uncomplexed fab compared to complex (1cly, 1clz)

SCOP Domain Sequences for d1ucbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucbl1 b.1.1.1 (L:4-108) Immunoglobulin (variable domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
mtqipvslpvslgdqasiscrssqiivhnngntylewylqkpgqspqlliykvsnrfsgv
pdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikr

SCOP Domain Coordinates for d1ucbl1:

Click to download the PDB-style file with coordinates for d1ucbl1.
(The format of our PDB-style files is described here.)

Timeline for d1ucbl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ucbl2