Lineage for d3ukrd2 (3ukr D:121-282)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3006006Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 3006007Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 3006008Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 3006009Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 3006013Domain d3ukrd2: 3ukr D:121-282 [200995]
    Other proteins in same PDB: d3ukra1, d3ukra2, d3ukrb_, d3ukrc_, d3ukre_, d3ukrf_, d3ukrg_
    automated match to d1k8kd2
    complexed with ckh

Details for d3ukrd2

PDB Entry: 3ukr (more details), 2.48 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d3ukrd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukrd2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

SCOPe Domain Coordinates for d3ukrd2:

Click to download the PDB-style file with coordinates for d3ukrd2.
(The format of our PDB-style files is described here.)

Timeline for d3ukrd2: