Lineage for d1yuhb1 (1yuh B:1-118)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219573Species Fab anti-nitrophenol (mouse), lambda L chain [48813] (1 PDB entry)
  8. 219575Domain d1yuhb1: 1yuh B:1-118 [20099]
    Other proteins in same PDB: d1yuha2, d1yuhb2, d1yuhh2, d1yuhl2
    complexed with np

Details for d1yuhb1

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuhb1 b.1.1.1 (B:1-118) Immunoglobulin (variable domains of L and H chains) {Fab anti-nitrophenol (mouse), lambda L chain}
qvqfqqsgaelvkpgasvklsckasgytftsylmhwikqrpgrglewigridpnnvvtkf
nekfkskatltvdkpsstaymelssltsedsavyycaryaycrpmdywgqgttvtvss

SCOP Domain Coordinates for d1yuhb1:

Click to download the PDB-style file with coordinates for d1yuhb1.
(The format of our PDB-style files is described here.)

Timeline for d1yuhb1: