SCOP 1.55: Domain d1yuhb1: 1yuh B:1-118

Lineage for d1yuhb1 (1yuh B:1-118)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab anti-nitrophenol (mouse), lambda L chain [48813] (1 PDB entry)

8. Domain d1yuhb1: 1yuh B:1-118 [20099]
   Other proteins in same PDB: d1yuha2, d1yuhb2, d1yuhh2, d1yuhl2

Details for d1yuhb1

PDB Entry: 1yuh, 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuhb1:

Sequence; same for both SEQRES and ATOM records:

>d1yuhb1 b.1.1.1 (B:1-118) Immunoglobulin (variable domains of L and H chains) {Fab anti-nitrophenol (mouse), lambda L chain}
qvqfqqsgaelvkpgasvklsckasgytftsylmhwikqrpgrglewigridpnnvvtkf
nekfkskatltvdkpsstaymelssltsedsavyycaryaycrpmdywgqgttvtvss

Timeline for d1yuhb1:

• d1yuhb1 appears in SCOP 1.57
  
• d1yuhb1 appears in the current release, SCOPe 2.08