SCOPe 2.05: Domain d3uinb_: 3uin B:

Lineage for d3uinb_ (3uin B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189560] (79 PDB entries)

8. Domain d3uinb_: 3uin B: [200985]
   Other proteins in same PDB: d3uina_, d3uinc_
   automated match to d2io0b_

Details for d3uinb_

PDB Entry: 3uin, 2.6 Å

PDB Description: complex between human rangap1-sumo2, ubc9 and the ir1 domain from ranbp2

PDB Compounds: (B:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d3uinb_:

Sequence; same for both SEQRES and ATOM records:

>d3uinb_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtgg

Timeline for d3uinb_:

• d3uinb_ first appeared in SCOPe 2.03
  
• d3uinb_ appears in SCOPe 2.04
  
• d3uinb_ appears in SCOPe 2.06
  
• d3uinb_ appears in the current release, SCOPe 2.08