SCOPe 2.03: Domain d1yuha1: 1yuh A:2-109

Lineage for d1yuha1 (1yuh A:2-109)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)
Domain d1yuha1: 1yuh A:2-109 [20098]
Other proteins in same PDB: d1yuha2, d1yuhb1, d1yuhb2, d1yuhh1, d1yuhh2, d1yuhl2
part of an anti-nitrophenol Fab
complexed with np

Details for d1yuha1

PDB Entry: 1yuh (more details), 3 Å

PDB Description: fab fragment

PDB Compounds: (A:) 88c6/12 fab (light chain)

SCOPe Domain Sequences for d1yuha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuha1 b.1.1.1 (A:2-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOPe Domain Coordinates for d1yuha1:

Click to download the PDB-style file with coordinates for d1yuha1.
(The format of our PDB-style files is described here.)

Timeline for d1yuha1: