SCOP 1.63: Domain d1yuha1: 1yuh A:2-109

Lineage for d1yuha1 (1yuh A:2-109)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab anti-nitrophenol (mouse), lambda L chain [48813] (1 PDB entry)

8. Domain d1yuha1: 1yuh A:2-109 [20098]
   Other proteins in same PDB: d1yuha2, d1yuhb2, d1yuhh2, d1yuhl2

Details for d1yuha1

PDB Entry: 1yuh, 3 Å

PDB Description: fab fragment

SCOP Domain Sequences for d1yuha1:

Sequence; same for both SEQRES and ATOM records:

>d1yuha1 b.1.1.1 (A:2-109) Immunoglobulin (variable domains of L and H chains) {Fab anti-nitrophenol (mouse), lambda L chain}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdrlftgliggtnnrgpgvp
arfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

Timeline for d1yuha1:

• d1yuha1 first appeared (with stable ids) in SCOP 1.55
  
• d1yuha1 appears in SCOP 1.61
  
• d1yuha1 appears in SCOP 1.65
  
• d1yuha1 appears in the current release, SCOPe 2.08