Lineage for d1vgeh1 (1vge H:1-122)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 362802Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (16 PDB entries)
  8. 362810Domain d1vgeh1: 1vge H:1-122 [20095]
    Other proteins in same PDB: d1vgeh2, d1vgel1, d1vgel2
    part of humanized Fab TR1.9

Details for d1vgeh1

PDB Entry: 1vge (more details), 2 Å

PDB Description: tr1.9 fab fragment of a human igg1 kappa autoantibody

SCOP Domain Sequences for d1vgeh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1}
qvklleqsgaevkkpgasvkvsckasgysftsyglhwvrqapgqrlewmgwisagtgntk
ysqkfrgrvtftrdtsattaymglsslrpedtavyycardpygggksefdywgqgtlvtv
ss

SCOP Domain Coordinates for d1vgeh1:

Click to download the PDB-style file with coordinates for d1vgeh1.
(The format of our PDB-style files is described here.)

Timeline for d1vgeh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vgeh2