SCOPe 2.04: Domain d1ngql1: 1ngq L:1-109

Lineage for d1ngql1 (1ngq L:1-109)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries)

8. Domain d1ngql1: 1ngq L:1-109 [20092]
   Other proteins in same PDB: d1ngqh1, d1ngqh2, d1ngql2
   part of Fab N1G9
   complexed with so4

Details for d1ngql1

PDB Entry: 1ngq, 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment

PDB Compounds: (L:) n1g9 (igg1-lambda)

SCOPe Domain Sequences for d1ngql1:

Sequence; same for both SEQRES and ATOM records:

>d1ngql1 b.1.1.1 (L:1-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

Timeline for d1ngql1:

• d1ngql1 first appeared (with stable ids) in SCOP 1.55
  
• d1ngql1 appears in SCOPe 2.03
  
• d1ngql1 appears in SCOPe 2.05
  
• d1ngql1 appears in the current release, SCOPe 2.08