Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein CD1, alpha-3 domain [88615] (5 species) |
Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries) |
Domain d3u0pe2: 3u0p E:184-277 [200916] Other proteins in same PDB: d3u0pa1, d3u0pa3, d3u0pb_, d3u0pc1, d3u0pc3, d3u0pd1, d3u0pd2, d3u0pe1, d3u0pf_ automated match to d1onqa1 complexed with gol, hex, lsc, nbu, so4, und |
PDB Entry: 3u0p (more details), 2.8 Å
SCOPe Domain Sequences for d3u0pe2:
Sequence, based on SEQRES records: (download)
>d3u0pe2 b.1.1.2 (E:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw ylratldvvageaaglscrvkhsslegqdivlyw
>d3u0pe2 b.1.1.2 (E:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} qvkpkawlsrlllvchvsgfypkpvwvpgdilpnadetwylrvkhssleqdivlyw
Timeline for d3u0pe2: