Lineage for d3u0pc1 (3u0p C:6-183)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182598Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 2182603Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (13 PDB entries)
  8. 2182610Domain d3u0pc1: 3u0p C:6-183 [200912]
    Other proteins in same PDB: d3u0pa2, d3u0pa3, d3u0pb_, d3u0pc2, d3u0pc3, d3u0pd1, d3u0pd2, d3u0pe2, d3u0pf_
    automated match to d1onqa2
    complexed with gol, hex, lsc, nbu, so4, und

Details for d3u0pc1

PDB Entry: 3u0p (more details), 2.8 Å

PDB Description: crystal structure of human cd1d-lysophosphatidylcholine
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3u0pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u0pc1 d.19.1.1 (C:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsqdsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgqasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllqgtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d3u0pc1:

Click to download the PDB-style file with coordinates for d3u0pc1.
(The format of our PDB-style files is described here.)

Timeline for d3u0pc1: