Lineage for d3tzcc_ (3tzc C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843526Species Vibrio cholerae [TaxId:593588] [189768] (3 PDB entries)
  8. 2843535Domain d3tzcc_: 3tzc C: [200905]
    automated match to d3tzcd_
    complexed with nap, so4

Details for d3tzcc_

PDB Entry: 3tzc (more details), 2.45 Å

PDB Description: crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae
PDB Compounds: (C:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d3tzcc_:

Sequence, based on SEQRES records: (download)

>d3tzcc_ c.2.1.2 (C:) automated matches {Vibrio cholerae [TaxId: 593588]}
sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
skavlrgmmkkrqgriinvgsvvgtmgnagqanfaaakagvigftksmarevasrgvtvn
tvapgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhv
nggmy

Sequence, based on observed residues (ATOM records): (download)

>d3tzcc_ c.2.1.2 (C:) automated matches {Vibrio cholerae [TaxId: 593588]}
sqfmnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgma
lnvtnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrl
skavlrgmmkkrqgriinvakagvigftksmarevasrgvtvntvapgfietdmeqrtat
laqvpagrlgdpreiasavaflaspeaayitgetlhvnggmy

SCOPe Domain Coordinates for d3tzcc_:

Click to download the PDB-style file with coordinates for d3tzcc_.
(The format of our PDB-style files is described here.)

Timeline for d3tzcc_: