SCOPe 2.06: Domain d1ngpl1: 1ngp L:1-109

Lineage for d1ngpl1 (1ngp L:1-109)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries)

8. Domain d1ngpl1: 1ngp L:1-109 [20090]
   Other proteins in same PDB: d1ngph1, d1ngph2, d1ngpl2
   part of Fab N1G9
   complexed with npa, so4

Details for d1ngpl1

PDB Entry: 1ngp, 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3- nitrophenyl) acetate

PDB Compounds: (L:) n1g9 (igg1-lambda)

SCOPe Domain Sequences for d1ngpl1:

Sequence; same for both SEQRES and ATOM records:

>d1ngpl1 b.1.1.1 (L:1-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

Timeline for d1ngpl1:

• d1ngpl1 first appeared (with stable ids) in SCOP 1.55
  
• d1ngpl1 appears in SCOPe 2.05
  
• d1ngpl1 appears in SCOPe 2.07
  
• d1ngpl1 appears in the current release, SCOPe 2.08